PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P09400_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 672aa    MW: 71422.6 Da    PI: 5.7059
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P09400_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS408.37.3e-1252966512374
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lLl+cAeav++++l +a+ lL ++sel++p g++ qR+aayf eA++arl++s+ +ly+ l++ + +     + ++a+++f+ +sP
  GSMUA_Achr8P09400_001 296 LTLLLQCAEAVAADNLDEASLLLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGLYSPLRTVPHR----HRLASAFQVFNGISP 379
                            579************************************************************999997....788999********* PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                            ++kfsh+taNq I ea+e e+rvHiiDfdi+qGlQWp L++ LasRp+gpp++R+Tgvgs    s e+le+tg+rL++fA++lg+pf+
  GSMUA_Achr8P09400_001 380 FVKFSHFTANQVIQEAFELEDRVHIIDFDIMQGLQWPGLFHILASRPNGPPHVRLTGVGS----SMEALEATGKRLSDFADTLGLPFD 463
                            ************************************************************....************************ PP

                   GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                            f + v++++ +l++e+L v+++EalaV++    h+l+d ++s ++    +L+l+++l Pkvv++veq+++  ++sFl+rf+ea++yys
  GSMUA_Achr8P09400_001 464 FVP-VVEKVGNLNPERLGVSRQEALAVHWLR--HSLYDVTGSDTN----TLWLLQRLAPKVVTMVEQDLSQ-AGSFLARFVEAIHYYS 543
                            ***.799**********************99..999999999999....********************98.899************* PP

                   GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                            alfdsl a+++++s+er+ vE++ll+rei+nv+a  g +r+ + + +++Wre+l+++GF+ v+l  +aa+qa lll +++sdgy++ e
  GSMUA_Achr8P09400_001 544 ALFDSLGASYGEDSQERHIVEQQLLSREIRNVLAVGGPARTGQVK-FSNWREKLSQSGFRGVSLAGNAAAQATLLLGMFPSDGYTLVE 630
                            ***************************************988877.****************************************** PP

                   GRAS 354 esgslvlgWkdrpLvsvSaWr 374
                            e+g+l lgWkd  L+++SaWr
  GSMUA_Achr8P09400_001 631 ENGTLKLGWKDLCLLTASAWR 651
                            ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.252269631IPR005202Transcription factor GRAS
PfamPF035142.5E-122296651IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MARKRLVSEL DLQPDSSYNP GRLPRRAATG ASSTSSGNPT CSGDFSGQPS VLLNPPSTLS  60
VDAAQHSPAA SLLLPATATA THSAPLFTSL PPPALPSLTV CGFSGLPLFP PETHRIALPA  120
SRAEGLQLVA SSVAGVGASD DAAAGTDWVD GIIRDIVCSS AAGGEVSIPQ IVNSVREIVH  180
PCNPGLAALL EFRLRDASMA PPLPETVPPA NTASYLSSAA AVAGVGWEEP ASRLQGAQQK  240
PQPPPQSRPP RSSNSASSDE ATAAAAAESA AAAAAAKEKR EELQQRKQEA EGLHLLTLLL  300
QCAEAVAADN LDEASLLLLE ISELSTPFGT SAQRVAAYFS EAMSARLVSS CLGLYSPLRT  360
VPHRHRLASA FQVFNGISPF VKFSHFTANQ VIQEAFELED RVHIIDFDIM QGLQWPGLFH  420
ILASRPNGPP HVRLTGVGSS MEALEATGKR LSDFADTLGL PFDFVPVVEK VGNLNPERLG  480
VSRQEALAVH WLRHSLYDVT GSDTNTLWLL QRLAPKVVTM VEQDLSQAGS FLARFVEAIH  540
YYSALFDSLG ASYGEDSQER HIVEQQLLSR EIRNVLAVGG PARTGQVKFS NWREKLSQSG  600
FRGVSLAGNA AAQATLLLGM FPSDGYTLVE ENGTLKLGWK DLCLLTASAW RPMIQHPSAT  660
STTTHLVDNS LE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-532956514375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411777.10.0PREDICTED: protein SCARECROW 2-like isoform X1
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLM0TNZ30.0M0TNZ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P09400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein